1.68 Rating by CuteStat

tutsout.com is 1 decade 5 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, tutsout.com is SAFE to browse.

PageSpeed Score
67
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: 1 ON 100

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
EZ Tutorials for Beginner to Advanced - Tutsout

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 2
H3 Headings: 4 H4 Headings: 1
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 13
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- erinappenzoller.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 11 Dec 2013 21:34:36 GMT
Server: Apache
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=3, must-revalidate
WP-Super-Cache: Served supercache file from PHP
Content-Encoding: gzip
Content-Length: 6418
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Launchpad.com Inc.
Registration Date: Dec 1, 2013, 12:00 AM 1 decade 5 months 2 days ago
Last Modified: Dec 2, 2013, 12:00 AM 1 decade 5 months 1 day ago
Expiration Date: Dec 1, 2014, 12:00 AM 9 years 5 months 1 day ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns6489.hostgator.com 192.254.234.252 United States of America United States of America
ns6490.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
tutsout.com A 14387 IP: 192.254.234.33
tutsout.com NS 86400 Target: ns6490.hostgator.com
tutsout.com NS 86400 Target: ns6489.hostgator.com
tutsout.com SOA 86400 MNAME: ns6489.hostgator.com
RNAME: dnsadmin.gator3245.hostgator.com
Serial: 2013120525
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
tutsout.com MX 14400 Target: tutsout.com
tutsout.com TXT 14400 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: TUTSOUT.COM
Registry Domain ID:
Registrar WHOIS Server: whois.launchpad.com
Registrar URL: LaunchPad.com
Updated Date: 02-Dec-2013
Creation Date: 01-Dec-2013
Registrar Registration Expiration Date: 01-Dec-2014
Registrar: Launchpad, Inc. (HostGator)
Registrar IANA ID: 955
Registrar Abuse Contact Email: abuse@websitewelcome.com
Registrar Abuse Contact Phone: +1.713-574-5287
Registration Service Provided By: LAUNCHPAD.COM, INC.
Domain Status: OK
Registry Registrant ID: HG_31377466
Registrant Name: Sumair Ahmed Khan Niazi
Registrant Organization: Graphic & Web Design
Registrant Street: L-455 Sector 2 North Karachi L4,st-1 Sector 2 North Karachi
Registrant City: Karachi
Registrant State/Province: Sindh
Registrant Postal Code: 75850
Registrant Country: PK
Registrant Phone: +92.3222137538
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: freelancerways@gmail.com
Registry Admin ID: HG_31377467
Admin Name: Sumair Ahmed Khan Niazi
Admin Organization: Graphic & Web Design
Admin Street: L-455 Sector 2 North Karachi L4,st-1 Sector 2 North Karachi
Admin City: Karachi
Admin State/Province: Sindh
Admin Postal Code: 75850
Admin Country: PK
Admin Phone: +92.3222137538
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: freelancerways@gmail.com
Registry Tech ID: HG_31377469
Tech Name: Sumair Ahmed Khan Niazi
Tech Organization: Graphic & Web Design
Tech Street: L-455 Sector 2 North Karachi L4,st-1 Sector 2 North Karachi
Tech City: Karachi
Tech State/Province: Sindh
Tech Postal Code: 75850
Tech Country: PK
Tech Phone: +92.3222137538
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: freelancerways@gmail.com
Name Server: ns6489.hostgator.com
Name Server: ns6490.hostgator.com

DNSSEC:Unsigned

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Launchpad, Inc. (HostGator).
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.

URL of the ICANN WHOIS Data Problem Reporting System:http://wdprs.internic.net/
Last update of WHOIS database: Wed Dec 11 21:34:50 GMT 2013